Protein Info for BWI76_RS14605 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 263 to 294 (32 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 55 to 319 (265 residues), 132.2 bits, see alignment E=1e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 98% identity to kpu:KP1_2776)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B428 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BWI76_RS14605 ABC transporter permease (Klebsiella michiganensis M5al)
MSIMNLSSSRMIQHSLPRRLLHNHSGVVSIALFFVFCCVVFSLITSNFLTGTNWLNIIRQ
SAPLLIVATAMTLVITTGGIDLSVGSTLALVGALSAIALNNWGLPWPVVLLGGLLLGGIV
GAINGFFIAYEGIPAFIVTLATLAVVRGIALLVTQGYSIPVPADSLFTFIGRAWVVGIPM
PALIGIMILLIGHIVLNHMRFGRYVTAIGANAEGARRSGINTKAVTMKVYIISGMAAALA
GMIITARLGSGSSNQGEGFELQVIAAVVLGSTSLFGGFGTIIGTLLGALSIAVIQNGLIL
SHISPFYTQIATGTIILLAIWLNTRILNPARSAAKG