Protein Info for BWI76_RS14590 in Klebsiella michiganensis M5al

Annotation: putative ABC transport system nucleotide binding/ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 41 to 291 (251 residues), 183.8 bits, see alignment E=6.8e-58 PF00532: Peripla_BP_1" amino acids 42 to 303 (262 residues), 65.7 bits, see alignment E=7.5e-22 PF13377: Peripla_BP_3" amino acids 160 to 305 (146 residues), 35.9 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 98% identity to kva:Kvar_2605)

Predicted SEED Role

"Ribose ABC transporter, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem Bacterial Chemotaxis (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B415 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS14590 putative ABC transport system nucleotide binding/ATPase component (Klebsiella michiganensis M5al)
MMLFNTGKLRLLAVATTMLASMSFISTAGAAAPTYALVQINQQALFFNLMNKGAQDAAKA
SGKDLVIFNSNDNPVAQNDAIENYIQQGVKGILVAAIDVNGIMPAVKEAAAANIPVIAID
AVLPAGPQAAQVGVDNIEGGRIIGQYFVDYVQKEMGGQARLGIVGALNSAIQNQRQKGFE
ETLKSNPKITIANVVDGQNVQDKAMTAAENLITGNPDLTAIYATGEPALLGAIAAVENQG
RQKDIKVFGWDLTAKAISGIDGGYVTAVLQQDPEKMGAEALKALNSITSGKTVPKTILVP
ATVVTKANVDSYRSLFK