Protein Info for BWI76_RS14540 in Klebsiella michiganensis M5al

Annotation: yersiniabactin biosynthetic protein YbtU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01761: thiazolinyl imide reductase" amino acids 8 to 348 (341 residues), 472 bits, see alignment E=7.8e-146 PF01408: GFO_IDH_MocA" amino acids 9 to 126 (118 residues), 94.4 bits, see alignment E=8.2e-31 PF21390: Irp3-like_C" amino acids 151 to 250 (100 residues), 150.9 bits, see alignment E=1.2e-48

Best Hits

KEGG orthology group: K04785, yersiniabactin synthetase, thiazolinyl reductase component (inferred from 85% identity to ecc:c2430)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>BWI76_RS14540 yersiniabactin biosynthetic protein YbtU (Klebsiella michiganensis M5al)
MMSSAAPKLRVLIVGAKFGEMYLNAFMQSQEGLELVGLLSQGSARSRELAYAFGIPLYTS
PEQIAEMPDIACIVVRSTVAGGSGTQLARHFLTRGVHVIQEHPLHPDDVRSLQALAQERG
RCYWVNTFYPHARAGRVWLGDAQRLRRSLGQAPSVVHATTSRQLLYSTLDLLLLALEVDA
ASVACEVVGSFSDFHCLRLFWPAGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSL
EASYGPVVWSSSLFVAEHQANVRSLYRRPEILRDPPGQTRSAAPLSWRDCCETAGPEGVG
RLLQQLRSYLAGGNLPAACHSAHQLALSHLWQQILRKTGHAEIRHLTPPRHDRLPAFYRH
DEESL