Protein Info for BWI76_RS14520 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 67 to 293 (227 residues), 77.2 bits, see alignment E=2.6e-25 PF00005: ABC_tran" amino acids 360 to 509 (150 residues), 111.4 bits, see alignment E=8.2e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 90% identity to ecq:ECED1_2247)

Predicted SEED Role

"Putative ABC iron siderophore transporter, fused permease and ATPase domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>BWI76_RS14520 hypothetical protein (Klebsiella michiganensis M5al)
MSSHSSNTESLSRFPLWQVITPVRGKVLLAMALAGLAAFTSLGALLFLAWCLRDLRGAPD
FIPVWPLSGVVGCVIATFILRLQAFNTSHYAAFHLENILRSRLAHKTLQLAPGALQQMGS
GSVAKVMLDDVKSLHIFVADSTPLYARAIIMPLATVVLVFWLDWRLAIATLGVLAFGSVV
LLLARQRSENMAQRYHQARERVSAAVIEFVQAMPVVRTFDSGSTSFLRYQHALEEWVDVL
KSWYRQAGFSARFSFSILNPLPTLFVLIWCGYGLLHAGSLDFIAWVAVLLIASGMAEAVM
PMMMLNNLVAQTRLSVQRIYQVLAMPELSRPRADRQPKEASITFEQVSFHYPQARTGAAL
QEVSFHVPVGQIVALVGPSGAGKSTVARLLLRYADPDKGHIRIGGVDLRDMRIETLMKQI
SFVFQDNFLFADTIANNIRLGAPDTPLESVIAAARVAQAHEFISALPEGYSTRVGERGVF
LSGGQRQRITIARALLQDRPILVLDEATAFADPEGEAALINALAAAMRGRTVIMVAHRLS
MVTQADVILLFSDGQLREIGSHGQLLAQGGLYQRLWQRYQQAQQWVPGGTQEEAVQNERH