Protein Info for BWI76_RS14515 in Klebsiella michiganensis M5al

Annotation: yersiniabactin-iron ABC transporter permease ATP-binding protein YbtQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 34 to 295 (262 residues), 36.1 bits, see alignment E=6.2e-13 PF00005: ABC_tran" amino acids 361 to 510 (150 residues), 104.7 bits, see alignment E=6.6e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 90% identity to eck:EC55989_2204)

Predicted SEED Role

"Inner membrane ABC-transporter YbtQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>BWI76_RS14515 yersiniabactin-iron ABC transporter permease ATP-binding protein YbtQ (Klebsiella michiganensis M5al)
MKDTNPADNLAWRAIWRQLISSVGSQAGTLRRSLVALLLAALMQGIAFACLYPIVDALLR
NEASRLLHWALAFSIAALVTLALRWYGLGFEYRGHLAQATHELRLRLGEQLRRVPLERLQ
RGRAGETNALLLGSVDENLNYVIAIANILLLTIVTPLTASLATLWIDWRLGLVMLLIFPL
LAPFYYWRRPAMRRQMQTLGEAHQRLSGDIVEFAQGMMVLRTCGSDTDKSRALRDHFNAL
ENLQTRTHRQSAGATMLIAGVVELGLQVVVLCGIIWVVTGTLNLAFLIAAAAMIMRFAEP
MAMFISYTSVVELIASALQRIEQFMAIAPLPVAERGEMPERYDIRFDNIHYRYDDSGDPA
LNDLSLTFPAASMSALVGASGAGKTTVSKLLMRYADPQQGRISIGGVDIRRLTAEQLNSL
ISVVFQDVWLFDDTLLANILIARPQATQQEVEEAARAAQCLEFITRLPQGWLTPMGEMGG
QLSGGERQRISIARALLKDAPIVILDEPTAALDIDSELAVQKAIDNLVHNRTVIIIAHRL
STIVGAGNILVMEEGKVVEQGTHAQLLSLHGRYQALWHAQMAARVWRAEGVSTSEEVAHE