Protein Info for BWI76_RS14510 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 328 to 353 (26 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 324 (300 residues), 42.9 bits, see alignment E=1.5e-15 amino acids 237 to 412 (176 residues), 34 bits, see alignment E=7.9e-13

Best Hits

KEGG orthology group: K05373, MFS transporter, putative signal transducer (inferred from 88% identity to ypk:y2395)

Predicted SEED Role

"Putative signal transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>BWI76_RS14510 MFS transporter (Klebsiella michiganensis M5al)
MSDVPSNVKPLTLTTGRVIFAIAGIYVTQSLVSALSMQSLPALVRAAGGSLALAGATTLF
MLPWALKFIWAPWVERWRLPPGSPQRRSRMLILRGQAALAAILAIAAAIGGTGREGGLPE
TLVAALFALFMVAGTVASTIDIASDGFCVDQLTRAGYGWGNSVQVGGSYLGMMCGGGVFL
MLSATVGWPAAMLMMAALILVLSVPLWRIAEPTRTASVPHVPALGYALRRRQARLGLMLV
LMLNSGMRFVLPLLAPLLLDHGLSMSALGALFSGGNIAAGIAGTLAGGLLMKYLSPGRAL
FAAYGAQGIALLAVVMTLKIAPGPLLLPILQVLIVVQSVSLACALVCLYATLMALSSPLQ
AGVDFTLFQCTDAAIAILAGVVGGVVAQRFGYAACFLFAGVFTLLAAWIVSIRLRSAKEL
MTSSID