Protein Info for BWI76_RS14490 in Klebsiella michiganensis M5al

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13531: SBP_bac_11" amino acids 52 to 290 (239 residues), 68.7 bits, see alignment E=1e-22 PF13416: SBP_bac_8" amino acids 77 to 309 (233 residues), 41.8 bits, see alignment E=1.7e-14 PF13343: SBP_bac_6" amino acids 86 to 310 (225 residues), 116.6 bits, see alignment E=2e-37

Best Hits

Swiss-Prot: 86% identical to PGTC_SALTY: Phosphoglycerate transport regulatory protein PgtC (pgtC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08478, phosphoglycerate transport regulatory protein PgtC (inferred from 92% identity to cko:CKO_02091)

Predicted SEED Role

"Phosphoglycerate transport regulatory protein PgtC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3T1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BWI76_RS14490 ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MNGITNRFFRRGGMLSKTWALWLLAAGFSPCTAQSEELVMATTFSPGATAWIIARWQTEP
GSVMIRTLNRTSASLEQLLDTANAENVDLVLTSSPMLLQHLQEHQKLAPFNGAPAGSQHL
VPESIRSTSVAVAMSGFGLLINRSALTTRHLPAPADWDDLTDPRYQGALLMSSPSRSDTN
HLMVESLLQQQGWVKGWQTLLASAGNLVTISSRSFGVADKIKSGLGVAGPVIDNYANLLL
NDPHLTFTYFPQSAVSPTYVAVLKNSQHASEARRFIRYLLSPEGQRILADANTGKYPVTP
LAAGNPRSAQQARLMNQPPLDYRLILKRQRLVQRMFDTAISFRLAQLKDAWRALHSAEAR
LKRPLPEIRALLTGVPVDPASSEDEAWLAQFDNKSFAEQQMMEWQLWFLNNQRQAIAKLE
ELK