Protein Info for BWI76_RS14485 in Klebsiella michiganensis M5al

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details PF00672: HAMP" amino acids 362 to 413 (52 residues), 27.9 bits, see alignment 3.7e-10 PF00512: HisKA" amino acids 451 to 513 (63 residues), 30.7 bits, see alignment E=4e-11 PF02518: HATPase_c" amino acids 558 to 662 (105 residues), 68.8 bits, see alignment E=8.2e-23

Best Hits

Swiss-Prot: 88% identical to PGTB_SALTY: Phosphoglycerate transport system sensor protein PgtB (pgtB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08475, two-component system, NtrC family, phosphoglycerate transport system sensor histidine kinase PgtB [EC: 2.7.13.3] (inferred from 95% identity to cko:CKO_02090)

Predicted SEED Role

"Phosphoglycerate transport system sensor protein PgtB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B454 at UniProt or InterPro

Protein Sequence (669 amino acids)

>BWI76_RS14485 two-component sensor histidine kinase (Klebsiella michiganensis M5al)
MMGRSMLQRLRQISISTSLRGAFLMGALLTLIVSGVSLYSWHEQSSQIRYSLDEYFPRIH
SAFLIEGNLNLVVDQLNEFLLAPNTTVRLQLRNQIIQHLDKIERLSQGLSPAERQQLAVI
LQDSRALLSELDRVLYNMFLVREKVGELSARIDWLHDDFTTELNSLVQDFTWQQGTLLDQ
IEARQGDAAQYLKRSREVQNEQQQVYTLARIENQIVDDLRDRLNELKSGNDDGMLVETHI
RYLENLKKTSDENIRALDDWPSTITLRQTIDELLEIGMVKNKMPDTMRDYVTAQKALVDA
SRAREATLGRFRTLLEAQLGSSHQQMQMFNQRMGQIVRVSGGLILVATLLALLLAWVLNH
YFIRSRLVKRFTALNQAVVQIGLGRTDATIPVYGRDELGRIAGLLRHTLGQLNAQKQQLE
QEIGERKTIEADLRATQDELIQTAKLAVVGQTMTTLAHEINQPLNALSMYLFTAGRAIEQ
GQTAQARATLSKAEGLINRIDAIIRSLRQFTRRAELETPLHPVDLRQTFMVAWELLAMRH
RPQQGTLVVPDETVWIRGDEVRVHQVLVNVLSNALDACPNAAKITVSWQMNGDTLSVLIA
DNGPGWPAALLPSLLKPFTTSKDVGLGIGLSICVSLMTQMEGTLRLASTLTRNACVVLQF
NLTDAKDVE