Protein Info for BWI76_RS14440 in Klebsiella michiganensis M5al

Annotation: glutamine ABC transporter permease GlnP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 134 to 142 (9 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 110 (99 residues), 95.1 bits, see alignment E=1.5e-31 PF00528: BPD_transp_1" amino acids 33 to 216 (184 residues), 92.3 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 69% identical to GLNP_ECOL6: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10037, glutamine transport system permease protein (inferred from 100% identity to kpn:KPN_pKPN5p08192)

MetaCyc: 69% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>BWI76_RS14440 glutamine ABC transporter permease GlnP (Klebsiella michiganensis M5al)
MNFETKYIWESLPLLLQGLQLTILISMVGLAGGFIIGLLAGVCRALGGGIAKTLSLIFVE
LIRGTPIMVQVMFIYFALPMILPVRIDPITAAMVTIIINSGAYIAEITRGAILSINRGFK
EASLAMGLSQRATLWHVIMPLALRRMIPALGNQWIISIKDTSLFIVIGVAELTRQGQEII
AGNFRALEVWTAVALIYLAVTLCLSFLLKQLEKRIHIL