Protein Info for BWI76_RS14240 in Klebsiella michiganensis M5al

Annotation: thiol reductase thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF00085: Thioredoxin" amino acids 4 to 101 (98 residues), 96.7 bits, see alignment E=3.8e-32 TIGR01068: thioredoxin" amino acids 7 to 104 (98 residues), 100 bits, see alignment E=3.6e-33

Best Hits

Swiss-Prot: 49% identical to THIO_PORPU: Thioredoxin (trxA) from Porphyra purpurea

KEGG orthology group: K03671, thioredoxin 1 (inferred from 57% identity to rha:RHA1_ro09066)

MetaCyc: 44% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>BWI76_RS14240 thiol reductase thioredoxin (Klebsiella michiganensis M5al)
MSIRELSTAEFSAEVLDASVPVLVDFWAPWCQPCRSVAPVIDALARENAGKLAVFKVNID
EQPELAAKHGIRSIPFFKIFVRGESVMEFSGARPKSDFDTLLTTVID