Protein Info for BWI76_RS14185 in Klebsiella michiganensis M5al

Annotation: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02798: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase
  • amino acids 8 to 228 (221 residues), 319.5 bits, E=5.7e-100
• PF03737: RraA-like
  • amino acids 31 to 178 (148 residues), 141.5 bits, E=1.3e-45

Best Hits

Swiss-Prot: 67% identical to GALC_PSEPK: 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase (galC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 90% identity to cro:ROD_31651)

MetaCyc: 67% identical to subunit of 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Pseudomonas putida)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]

Predicted SEED Role

"4-carboxy-4-hydroxy-2-oxoadipate aldolase (EC 4.1.3.17)" (EC 4.1.3.17)

MetaCyc Pathways

• gallate degradation I (4/4 steps found)
• gallate degradation II (4/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• methylgallate degradation (4/6 steps found)
• 4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
• syringate degradation (6/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• C5-Branched dibasic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.17

Protein Sequence (237 amino acids)

>BWI76_RS14185 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (Klebsiella michiganensis M5al)
MNLLNRKGIVVRSLPRHDNIALRQLTAAGVATLHEAYDRQGLMAPHIRPIQQGICRAGNA
VTVLVTPGDNWMFHVAVEQCRPGDILVVAPTSPCGDGFFGDLLATSLQSRGVVGLVGDIG
IRDSHTLRDMGFAVWSRQVYAQGTVKETLGSVNVPIICAGQLVTPGDVVVADDDGVVVIP
HSLVPEVLAKAETRMATEEAKRERMGSGELGLDIYAMRPRLAEKGLRYYDRAEDVES