Protein Info for BWI76_RS14180 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04303: PrpF
  • amino acids 3 to 351 (349 residues), 348.5 bits, E=2.3e-108

Best Hits

Swiss-Prot: 71% identical to GALD_PSEPK: 4-oxalomesaconate tautomerase (galD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09788, hypothetical protein (inferred from 90% identity to cro:ROD_31661)

MetaCyc: 71% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

"FldA protein"

MetaCyc Pathways

• gallate degradation I (4/4 steps found)
• gallate degradation II (4/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• methylgallate degradation (4/6 steps found)
• syringate degradation (6/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Protein Sequence (361 amino acids)

>BWI76_RS14180 hypothetical protein (Klebsiella michiganensis M5al)
MAQRRIPCLLMRGGTSKAACFLADDLPVDPASRDAVLLATMGSPDTRQIDGIGGADPLTS
KVAIIRRSARPDADIDYLFAQVNVDRAVVDYGQNCGNILAVVGPFAIERGLVDCVAPLTR
VRIFMENTGQIAVAEVPCNTGGVEYAGDTRIDGVPGTASKIVLNFLDVAGSSCGALLPTG
QASDRFDGIEVTCIDNGMPVVLIRASDLGRTGYETREQLDADDELKQRLETIRLQAGPRM
NLGDVTQRTVPKMTLIARPRAGGAISSRTFIPHRCHASIGVFGAVSVASACLIPGSVAQA
LASLERTPELSVEHPTGEFSVALRLDDNGQLAGCGLLRTARLLFAGDVCIPADVWPRKEL
L