Protein Info for BWI76_RS14115 in Klebsiella michiganensis M5al

Annotation: YqaE/Pmp3 family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 53 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details PF01679: Pmp3" amino acids 3 to 48 (46 residues), 68.6 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 88% identical to YQAE_ECOLI: UPF0057 membrane protein YqaE (yqaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to kpe:KPK_2957)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3Y3 at UniProt or InterPro

Protein Sequence (53 amino acids)

>BWI76_RS14115 YqaE/Pmp3 family membrane protein (Klebsiella michiganensis M5al)
MGFWRIVLTIILPPLGVLLGKGFGWAFILNIILTILGYIPGLIHAFWVQTKNT