Protein Info for BWI76_RS14105 in Klebsiella michiganensis M5al

Annotation: NADH:ubiquinone reductase (Na(+)-transporting) subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details TIGR01940: NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit" amino acids 8 to 201 (194 residues), 306.2 bits, see alignment E=7.8e-96 PF02508: Rnf-Nqr" amino acids 10 to 201 (192 residues), 167.4 bits, see alignment E=1.7e-53

Best Hits

Swiss-Prot: 79% identical to NQRE_YERPE: Na(+)-translocating NADH-quinone reductase subunit E (nqrE) from Yersinia pestis

KEGG orthology group: K00350, Na+-transporting NADH:ubiquinone oxidoreductase subunit E [EC: 1.6.5.-] (inferred from 78% identity to ypk:y2376)

MetaCyc: 65% identical to Na(+)-translocating NADH-quinone reductase subunit E (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit E (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3U2 at UniProt or InterPro

Protein Sequence (203 amino acids)

>BWI76_RS14105 NADH:ubiquinone reductase (Na(+)-transporting) subunit E (Klebsiella michiganensis M5al)
MEVVLFESHLNIFIRAVFVENMALNFFLGMCTFLAISKKIDVAFRLGVTVTALLAIATPI
NNLIYNHLLKENALIEGVDLSFLDFITFIGVLAALVQILEMVIDKYFHALNHALGPFLPL
LTIHCAIFGATIFMVQREYSFFESLTYGTGCGIGWALAIVALAGIREKLKYANMPKGLRG
LGSVFITAGLMSLGFMSFAGISL