Protein Info for BWI76_RS14095 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF02638: GHL10" amino acids 57 to 391 (335 residues), 395.5 bits, see alignment E=8e-123

Best Hits

Swiss-Prot: 76% identical to YDDW_ECOL6: UPF0748 lipoprotein YddW (yddW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 82% identity to rah:Rahaq_4440)

Predicted SEED Role

"COG1649 predicted glycoside hydrolase" in subsystem Predicted carbohydrate hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3S6 at UniProt or InterPro

Protein Sequence (441 amino acids)

>BWI76_RS14095 hypothetical protein (Klebsiella michiganensis M5al)
MTIRSCKFLLNKVKISAVAIAAALLLAHCGSKPPVSLVTPMPPATRQPTLPKSHEPVRGV
WLTTVSRLDWPPLESVNGGITADRRIALQQQALTAKLDNLKSLGINTVFFQVKPDGTALW
PSKILPWSDMLTGKIGEDPGYDPLKFMLDEAHKRGMRVHAWFNPYRVSVNTRPKTVTELN
GTLSQVPASVYVLHPEWIRTSGDRFVLDPGIPEVRDWITSIVAEVVEHYPVDGVQFDDYF
YTESPGSALNDSRTFQQYGQGFAAKADWRRHNTQLLIEQVSRTIKQLNPEVEFGVSPAGV
WRNRSHDPAGSDTRGAAAYDESYADTRLWVQQGWLDYIAPQIYWPFARDAARYDVLAKWW
ADVVKPTHTHLYIGVALYKVGEPSKNEPDWMINGGVPELKKQLDLNESMPQIQGTILFRE
NYLNQPQTQQAVNYLKSRWGG