Protein Info for BWI76_RS14030 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 57 to 80 (24 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 67 to 238 (172 residues), 102.5 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 50% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 87% identity to kpe:KPK_2555)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B417 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS14030 ABC transporter permease (Klebsiella michiganensis M5al)
MSARLFRAAVVFCGLLLLWWLASRSGIPAFLLPSPSAVASALWVNRSYLGEHTLITLSEI
LSGLVLGALLGVTLALCMIVSPRLQRWLMPLVLTSQAIPVFALAPLLVLWFGFGMGAKVM
MAVLVIFFPVTSAFFDGLRRVNRDYLDLARTMGASFGAQLRHVRMMAALPALGSGLRMAA
AVAPIGAIIGEWVGSAEGLGYVMLNANARLQTDICFAALFILVVLTVLLWLAVDAFLHRL
IDWTPE