Protein Info for BWI76_RS14025 in Klebsiella michiganensis M5al

Annotation: NMT1/THI5 like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF09084: NMT1" amino acids 34 to 244 (211 residues), 234.2 bits, see alignment E=8.3e-74

Best Hits

Swiss-Prot: 50% identical to Y357_HAEIN: Putative thiamine biosynthesis protein HI_0357 (HI_0357) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 86% identity to kpu:KP1_2851)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3W6 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BWI76_RS14025 NMT1/THI5 like domain-containing protein (Klebsiella michiganensis M5al)
MRKHLYSGMALGVLFSGQALANEKLTLVLDWYINPDHAPIVVAEQIGAFKEAGLDVKIVP
PSDPALPPRLVAARQADLAITYQPQVHFFADEGLPLVRVGTLINSPLNTVIALDKSIKSP
ADLQGKKVGYSVSGIEQATLATMAQHAHIDPKSIKLINVNFQLTSALLAGQVDAVIGGYR
NIEALELKLQGKDPQVMNVEDYGVPAYDELVIVANRDEANAPKIKAFLKALQKGVAYLRA
HPQETWQAFAAAHPELNTELNKQAWLKTLPLFASDPAALDKPRYEAYEQFLYNNKLVKKV
TPLTNYAVELH