Protein Info for BWI76_RS14020 in Klebsiella michiganensis M5al

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00709: 2,4-diaminobutyrate 4-transaminase" amino acids 22 to 455 (434 residues), 704.5 bits, see alignment E=2.3e-216 PF00202: Aminotran_3" amino acids 40 to 453 (414 residues), 334.6 bits, see alignment E=3.7e-104

Best Hits

Swiss-Prot: 64% identical to DAT_HAEIN: Diaminobutyrate--2-oxoglutarate aminotransferase (dat) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00836, diaminobutyrate-2-oxoglutarate transaminase [EC: 2.6.1.76] (inferred from 96% identity to kva:Kvar_2499)

MetaCyc: 68% identical to diaminobutyrate--2-oxoglutarate transaminase monomer (Acinetobacter baumannii AYE)
Diaminobutyrate--2-oxoglutarate transaminase. [EC: 2.6.1.76]

Predicted SEED Role

"Diaminobutyrate--2-oxoglutarate aminotransferase (EC 2.6.1.76)" (EC 2.6.1.76)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3M7 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BWI76_RS14020 aspartate aminotransferase family protein (Klebsiella michiganensis M5al)
MMTDKVRIDTLGADLLDANNDTFLARQAEFESNVRSYPRKLPLAITKAEGVWLTDADNKQ
YLDCLAGAGTLALGHNHPDVLQSIQSVITSGLPLHTLDLTTPLKDRFSEYLLSLLPGEGK
EYCLQFTGPSGADAVEAALKLAKKYTGRSSVISFSGGYHGMTHGALSVTGNLSPKAAVNG
MMPEVQFMPYPHQYRCPLGIGGEAGVKALTYYFENLINDVESGVRKPAAVILEAVQGEGG
VNPAPVEWLQRIRKVTQEHGILLIIDEVQAGFARTGKFFAFEHAGIEPDIIVMSKAVGGG
LPLAVLGIKKQFDAWEPGHHTGTFRGNQLAMATGLTTLRHLKDNKIADKTAAQGEWLKGK
LAEMQKRYPVIGHVRGLGLMIGIEIVKPNEAPDHMGCYPADGELSALLQKKCFEAGLILE
RGGRHGCVLRLLPSLLISNAELEIFFDKFEQALLAAGVKPV