Protein Info for BWI76_RS14010 in Klebsiella michiganensis M5al

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00106: adh_short" amino acids 6 to 197 (192 residues), 156 bits, see alignment E=1.7e-49 PF08659: KR" amino acids 6 to 160 (155 residues), 44.1 bits, see alignment E=4.4e-15 PF01370: Epimerase" amino acids 7 to 121 (115 residues), 26 bits, see alignment E=1.2e-09 PF13561: adh_short_C2" amino acids 11 to 195 (185 residues), 106 bits, see alignment E=4.8e-34

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 70% identity to atu:Atu5444)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3M8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>BWI76_RS14010 SDR family oxidoreductase (Klebsiella michiganensis M5al)
MSSKSAVLVTGASTGIGAVYAERFARRGHDLVLVARNRERLTALAERLRGETGVQVDILQ
ADLTQDSDIIAVEQRLREDARIGILVNNAGTSIPGDFLHQSSDDITRLITLNVTSVARLA
NAIAPRLAEAGEGAIVNIASVVGLGPEMGLTVYGATKAFVLFLSQGLDVELNAKGVYVQA
VLPAATRTEIWQHSGKDVDTIPGVMEVDKLVDAALVGFDRRESVTIPPLHDETQWQALNA
TRQAMLPGFAQSEPAARYLG