Protein Info for BWI76_RS13975 in Klebsiella michiganensis M5al

Annotation: urea carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03425: urea carboxylase-associated protein 2
  • amino acids 13 to 240 (228 residues), 303.8 bits, E=3.3e-95
• PF09347: DUF1989
  • amino acids 15 to 186 (172 residues), 192.3 bits, E=2.5e-61

Best Hits

KEGG orthology group: K09967, hypothetical protein (inferred from 91% identity to kpe:KPK_2624)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

See A0A285B3V8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>BWI76_RS13975 urea carboxylase (Klebsiella michiganensis M5al)
MTALFHSSPSLREERLPGGAHTSLILRKGQILRLTDIDGGANVSMMMLNPHEKSERLNLP
DTLKGQHTARLTAGHCFYSDMGRVLAGIVADSCGWHDPFGGVLNADETREKYGAGRYQEL
RNGFYRNGVDNLLVEMGKWDLGLEDLLMVVNFFSKVTVDEDGSFRFIPGNSRAGDYVELF
APMDVLMVLTALPHPQDPAAEYAPRPIQLSWYQADDAQATAEALFTRDENQRAFLNTQLF
AL