Protein Info for BWI76_RS13915 in Klebsiella michiganensis M5al

Annotation: magnesium transport protein MgtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details PF02308: MgtC" amino acids 10 to 129 (120 residues), 138.5 bits, see alignment E=1.5e-44 PF21770: MgtC_SapB_C" amino acids 145 to 222 (78 residues), 39.8 bits, see alignment E=5.3e-14

Best Hits

Swiss-Prot: 76% identical to MGTC_SALTI: Protein MgtC (mgtC) from Salmonella typhi

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 78% identity to esc:Entcl_1058)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3K9 at UniProt or InterPro

Protein Sequence (227 amino acids)

>BWI76_RS13915 magnesium transport protein MgtC (Klebsiella michiganensis M5al)
MLMFPYIANLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSVAASPDSPGR
IAAQVVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAAIGVLCGLGQFWQAAAATLIILC
ANILLREAAQRINHIPGATEEEKCYVLNIICHSEHENAIRQQLLAISKEMRLSLLGLASI
TAQEQGHKEIRIELVGNADYRKARDLIMEKIGGHENITSVRWAIEGS