Protein Info for BWI76_RS13880 in Klebsiella michiganensis M5al

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 39 to 64 (26 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details PF01810: LysE" amino acids 13 to 202 (190 residues), 113.3 bits, see alignment E=5.2e-37

Best Hits

KEGG orthology group: None (inferred from 58% identity to tcu:Tcur_0887)

Predicted SEED Role

"RhtB family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3U0 at UniProt or InterPro

Protein Sequence (205 amino acids)

>BWI76_RS13880 lysine transporter LysE (Klebsiella michiganensis M5al)
MALISPEFLLTSLIVVIAPGTGTLYTIATGLAAGRRMSFAAAFGCTLGIIPHMLAAITGL
AAILHSTPGAFELVKYAGVAWLLYLAWATLTQRGSLSVEGVVQRNPRQVISHAILINLLN
PKLPLFFLAFLPQFMQRGSASPVREMLILSAMFMLMTLLVFMLYGAFAAAMRGYVLTRPR
VLQGLRVSFAAGFVGLGIKLILAQR