Protein Info for BWI76_RS13865 in Klebsiella michiganensis M5al

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 294 (280 residues), 231.7 bits, see alignment E=5.2e-73 PF01545: Cation_efflux" amino acids 19 to 212 (194 residues), 168.1 bits, see alignment E=2.1e-53 PF16916: ZT_dimer" amino acids 217 to 293 (77 residues), 81.6 bits, see alignment E=3.6e-27

Best Hits

KEGG orthology group: None (inferred from 76% identity to eae:EAE_19695)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3J5 at UniProt or InterPro

Protein Sequence (302 amino acids)

>BWI76_RS13865 cation diffusion facilitator family transporter (Klebsiella michiganensis M5al)
MSGMTDENRRSQVARKTTLVSVVVNLFLSSAQVLAGVFCGSQGLIADGIHSLSDLVADFV
VLLANKKSRQPSDDDHPYGHWRYENGASLAIGALLLLVGAGMLWSACDKLWHPESIQNVH
ITALWVALAALVAKEILFRYMLRAAKQIHSSMLIANAWHARSDAASSVVVAVGIIGNLAG
FAWLDPVAALVVGALVTRMGYTFSSDALHDLMDRSVDRDTEQQITATILATPGVAALHDL
KTRRAGDFILVDVHIEVPGNLSVAQGHDIALTARSRVLNSHNVMHMMIHIDPCRAEIAAM
NT