Protein Info for BWI76_RS13810 in Klebsiella michiganensis M5al

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF12802: MarR_2" amino acids 32 to 89 (58 residues), 41.3 bits, see alignment E=4.8e-14 PF01047: MarR" amino acids 34 to 89 (56 residues), 28.5 bits, see alignment E=4.1e-10 PF09339: HTH_IclR" amino acids 47 to 79 (33 residues), 23.6 bits, see alignment 1.3e-08 PF13463: HTH_27" amino acids 48 to 99 (52 residues), 25.8 bits, see alignment 3.7e-09 PF00583: Acetyltransf_1" amino acids 195 to 290 (96 residues), 56.4 bits, see alignment E=1.3e-18 PF13673: Acetyltransf_10" amino acids 196 to 297 (102 residues), 49.7 bits, see alignment E=1.3e-16 PF13508: Acetyltransf_7" amino acids 206 to 291 (86 residues), 49.8 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: None (inferred from 74% identity to eae:EAE_19755)

Predicted SEED Role

"Transcriptional regulator, MarR family / Acetyltransferase (GNAT)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3S5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>BWI76_RS13810 MarR family transcriptional regulator (Klebsiella michiganensis M5al)
MTSSPLIDEIRTASRLMVRELGFMSATLAATDYSPSAVHTLLEISLRGAMTAAQLVQILG
LEKSSVSRMLARLVTAGELQEIPSAGDGRFKQLALTAKGAATVAKVNAYGAMRVVNALAH
LSDEQKQGVAQGLTDWAWALEKCRDVEATAAKQAIAIVTGYRPGMIGRIAQMHGEYYAKH
YGFGHFFESKVACGLAEFSGRLDKPRNQVWLAVQGEQIVGSVAIDGEDLGNNQAHLRWFI
LDDSCRGSGIGRRLLNEALAFCDSQGFAAVQLWTFSGLNAARRLYESFGFTLHKEWQGDQ
WGRMMTEQQFSRQQARAE