Protein Info for BWI76_RS13790 in Klebsiella michiganensis M5al

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 103 to 123 (21 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 105 (105 residues), 28.3 bits, see alignment E=1.7e-10 PF00528: BPD_transp_1" amino acids 125 to 307 (183 residues), 94.4 bits, see alignment E=7.2e-31

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 89% identity to kpn:KPN_01855)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3W7 at UniProt or InterPro

Protein Sequence (314 amino acids)

>BWI76_RS13790 peptide ABC transporter permease (Klebsiella michiganensis M5al)
MSHYLLRRSGQGLLVLWAAFTLSFALLQVLPGDAVLIKFQNPDLGLSPEQIAEMRLAYGA
DSPLWKQYFHTLWAMLRGDFGYSLQAGLPVSALIASNLPETLSLALPAFALAVALAFTLA
LASRLPGLRWLSNALQSLPVLFISLPTFWLGIALIQLFSFQLRWIPVINPGPVEGLILPI
IAVAVPISAPLAQILMHSLDQVAAQPFVAVARAKGLSETGVLWRHVTGNALLPVLNIAGL
LLGELIAGALITETVFGRGGLGLLTQQAVNNQDIAVLQAVVMISALGFVLINLLVDLLMP
LFDPRLKTVIGGAV