Protein Info for BWI76_RS13785 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 275 (172 residues), 87.7 bits, see alignment E=4.3e-29

Best Hits

Swiss-Prot: 36% identical to DPPC_ECOL6: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 87% identity to kpe:KPK_2500)

MetaCyc: 36% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3S0 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS13785 ABC transporter permease (Klebsiella michiganensis M5al)
MSLVDYAIAARRRRVNWRTLRVQPGLLLAWTVTIVAALMAIAPQLFTAYNPLEGLPGAQR
LAPQAGHWLGTDQLGRDLWSRIVYGAVHSLSAALAAVAIGLFIGTALGTLAGALAGRVES
AIMRLVDVLLAIPSLLLSLTVIILLGFGTLNAAVAVGVAAIASFARLARAEVVRVRHSDF
VEAAYGSGGTFFAVFWRHILPNSLTAVLAFATLQFGQAILALSTLSFLGYGTPPPVPEWG
LLIAEGRNYLSTAWWLTTLPGLAVIAVVLAANRISRQFSGERP