Protein Info for BWI76_RS13780 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF00005: ABC_tran" amino acids 23 to 182 (160 residues), 113.4 bits, see alignment E=6.5e-36 amino acids 296 to 448 (153 residues), 118.6 bits, see alignment E=1.6e-37 PF13304: AAA_21" amino acids 137 to 216 (80 residues), 33.9 bits, see alignment E=1.8e-11 PF08352: oligo_HPY" amino acids 499 to 531 (33 residues), 22.9 bits, see alignment (E = 4.3e-08)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 86% identity to kpu:KP1_2920)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3H5 at UniProt or InterPro

Protein Sequence (534 amino acids)

>BWI76_RS13780 ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MNVLTVENLRISYRSQREWREVVHDVSFAVKRGEMLAFVGESGSGKTTTAQAIIGLLADN
ARRDSGRILINGEEISGWSAKRLDGLRGARISLVPQDPGNSLNPVKTIGAQVGEILRLHQ
QSSAAERKAQVLALLAKVGLSHPEQRIDQYPHQLSGGMKQRVLIAIAIALKPDLIIADEP
TSALDVTVQKRILDLLDTLRRESGTAVLFVTHDLALAAERADRLLVFRHGEIQEQGATGD
VVRTPQHAYTRQLLSDLQGSTLTIAPASGRVLATPAIRVEGISKRFSLGRAHLQALDAVS
FEVKRGSTHALVGESGSGKTTLARILLGFEKADVGHIAIDGIDAGHLSREALRQLRRKIQ
FVYQNPFASLDPRQTLFEIIEEPLKNFDRLNAETRRQRVETVAARVALAPELLSRTAREL
SGGQRQRVAIARALILEPTILVLDEATSALDVTVQAQILALLQQLQQQLGLSYLFITHDL
ATVRRIAHSVTVLRAGQVVEHGDVSRLFSAPQHDYTRELIAAIPHFSSPSKEVA