Protein Info for BWI76_RS13770 in Klebsiella michiganensis M5al

Annotation: alkylhydroperoxidase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR04030: alkylhydroperoxidase domain protein, Avi_7169 family" amino acids 174 to 360 (187 residues), 289.3 bits, see alignment E=2.9e-90 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 188 to 360 (173 residues), 135.5 bits, see alignment E=3.4e-43 PF02627: CMD" amino acids 227 to 288 (62 residues), 43.1 bits, see alignment E=1.8e-15 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 241 to 288 (48 residues), 39.4 bits, see alignment 6.5e-14

Best Hits

KEGG orthology group: None (inferred from 83% identity to kva:Kvar_2445)

Predicted SEED Role

"Alkylhydroperoxidase AhpD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3H4 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BWI76_RS13770 alkylhydroperoxidase domain protein (Klebsiella michiganensis M5al)
MTLSQDILAELAEIAPDSALAAARAAREAATRHAQGSYETLFGQQDNDFPLDERFAVAAR
VAKLHDSDALAAHYAGFGIADPTSPRLAPALAFARLLTFTPVEATPSPLEALIRAGWTLR
GIVTLAQLIAFVSFQSRLVTGLRLLNGKSITVAQTPVAAGFWHTSPQTLSGKRAPVRFTR
DELYWEPWLAAKPLAEFSPDEQALLAKFGHSDSPYFRLLARNQPILEQRTLTDKGIFYTP
GGLPRAERELAATVASKVNGCIYCASVHARKAAQLAKDETAVETLLAVTPGENLSDGQTP
GWQAQIDFAAAISVTPPALAAGHLAAVEQQGLDTLAQLDLLQSAAFFAWANRLMLTLGEP
WQE