Protein Info for BWI76_RS13715 in Klebsiella michiganensis M5al

Annotation: 2-chlorobenzoate 1 2-dioxygenase electron transfer subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 9 to 86 (78 residues), 61.4 bits, E=9.6e-21
• PF00970: FAD_binding_6
  • amino acids 112 to 200 (89 residues), 46.9 bits, E=4.5e-16
• PF00175: NAD_binding_1
  • amino acids 210 to 312 (103 residues), 77 bits, E=2.6e-25

Best Hits

Swiss-Prot: 55% identical to XYLZ_PSEPU: Toluate 1,2-dioxygenase electron transfer component (xylZ) from Pseudomonas putida

KEGG orthology group: K05784, benzoate 1,2-dioxygenase electron transfer component (inferred from 86% identity to kpe:KPK_2486)

MetaCyc: 55% identical to XylZ (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"benzoate dioxygenase, ferredoxin reductase component" in subsystem Benzoate degradation

MetaCyc Pathways

• mandelate degradation to acetyl-CoA (14/18 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See A0A285B3L4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BWI76_RS13715 2-chlorobenzoate 1 2-dioxygenase electron transfer subunit (Klebsiella michiganensis M5al)
MTFNIALNFEDGITRFIQCHAGEKVLDAAYRQQVNLPMDCSDGVCGTCKCRCVSGEYGLG
DDFLEEALSEDEAAERQVLTCQMVPTSDCVIDVPAAAAQCKTALASLGAAVKQVNLLSDT
AIELVVVLDEPLDFLPGQYINIEVPGTPQARAYSFSSLPGSREGSFLIRNVPGGLMSQWL
TQRASPGDRLTLSGPMGSFYLRGGERPLLLLAGGTGLAPLLSMLQTLVMQRSTRPVTLLY
GVTRDCDLVKTDALEAFTGQLPAYRWLPVVADAQSGCPQRGFVTEHLDDAILNDGDVDIY
LCGPPPMVNAVATALRERGVSPAGFWYEKFIASQSAAA