Protein Info for BWI76_RS13710 in Klebsiella michiganensis M5al

Annotation: benzoate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03232: benzoate 1,2-dioxygenase, small subunit
  • amino acids 7 to 161 (155 residues), 232.9 bits, E=7.6e-74
• PF00866: Ring_hydroxyl_B
  • amino acids 14 to 153 (140 residues), 147.7 bits, E=1.3e-47

Best Hits

Swiss-Prot: 56% identical to BENB_ACIAD: Benzoate 1,2-dioxygenase subunit beta (benB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05550, benzoate 1,2-dioxygenase beta subunit [EC: 1.14.12.10] (inferred from 88% identity to kpu:KP1_2936)

MetaCyc: 56% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• mandelate degradation to acetyl-CoA (14/18 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See A0A285B3G6 at UniProt or InterPro

Protein Sequence (161 amino acids)

>BWI76_RS13710 benzoate 1,2-dioxygenase small subunit (Klebsiella michiganensis M5al)
MLTLEQVRQFLYYEARLLDDRQWDEWLNCYSPQVVYWMPAWGDDDQLTRDPQREISLIYY
PNRDGLEDRVYRIKTERSGASTPEPRTTHMIGNVERLGETEQGMEVRYNWVTYCHRYQQT
DTWFGSTCCTLIESAGKPQIIRKTVRLNNDYIRQVIDVYHI