Protein Info for BWI76_RS13705 in Klebsiella michiganensis M5al

Annotation: Rieske (2Fe-2S) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 49 to 132 (84 residues), 71.3 bits, E=5.2e-24
• PF00848: Ring_hydroxyl_A
  • amino acids 200 to 403 (204 residues), 56.6 bits, E=3.5e-19

Best Hits

Swiss-Prot: 60% identical to CBDA_BURCE: 2-halobenzoate 1,2-dioxygenase large subunit (cbdA) from Burkholderia cepacia

KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 93% identity to kpe:KPK_2484)

MetaCyc: 60% identical to 2-halobenzoate 1,2-dioxygenase large subunit (Burkholderia cepacia 2CBS)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• mandelate degradation to acetyl-CoA (14/18 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See A0A285B3Q5 at UniProt or InterPro

Protein Sequence (460 amino acids)

>BWI76_RS13705 Rieske (2Fe-2S) domain-containing protein (Klebsiella michiganensis M5al)
MQKTFARLKDKISNALIVDREKHIYRCHRSIFTDPQLFDFEMKHIFEGNWLFLAHESQIA
QPGDYYTLTLGRQPVIITRDKKNELHALINSCAHRGAMLCRRKTGNKNSLTCPFHGWTFS
NNGKLLKAKDESTGGYPDSFKQEGSHDLTKLPKFQSYRGFLFGSLNADVQPLEEYLGETR
KIIDLIVDQAPQGLEVLKGSSSYVYEGNWKLGAENGADGYHVSVVHWNYASTMSRRNYEA
EGTHAVDANGWSKSVGGGYGFENGHMLLWTRALNPEVRPVYEHRERLRAEFGESRADRMV
NETRNLCLYPNVYLMDQFSTQIRVIRPIAVDKTEVTIWCFAPRGESDQARALRIRQYEDF
FNVSGMGTPDDLEEFSACQRGYLGENLAWSDLSRGALHWVDGPDDHALQAGFSPQLSGVK
SEDEALYIAHHHHWQNVMLAALETERQRYDQSITQRVEVA