Protein Info for BWI76_RS13700 in Klebsiella michiganensis M5al

Annotation: catechol 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02439: catechol 1,2-dioxygenase
  • amino acids 10 to 289 (280 residues), 450 bits, E=1.3e-139
• PF04444: Dioxygenase_N
  • amino acids 27 to 94 (68 residues), 78.5 bits, E=2.7e-26
• PF00775: Dioxygenase_C
  • amino acids 105 to 289 (185 residues), 225.7 bits, E=3.1e-71

Best Hits

Swiss-Prot: 54% identical to CATA_ACIAD: Catechol 1,2-dioxygenase (catA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_19900)

MetaCyc: 56% identical to 4-methylcatechol 1,2-dioxygenase [multifunctional] (Pseudomonas reinekei)
1.13.11.M6 [EC: 1.13.11.M6]; Catechol 1,2-dioxygenase. [EC: 1.13.11.M6, 1.13.11.1]; RXN-10080 [EC: 1.13.11.M6, 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• mandelate degradation to acetyl-CoA (14/18 steps found)
• 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
• 4-chlorocatechol degradation (3/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• chlorosalicylate degradation (3/7 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.1 or 1.13.11.M6

Sequence Analysis Tools

See A0A285B3J2 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BWI76_RS13700 catechol 1,2-dioxygenase (Klebsiella michiganensis M5al)
MSNAFVQPDAVQNLLRESAGLNISGGDERFKTIIHRLLENICTLIDDYNITEEEFWHAVN
YLHELGGRQEAALLAAGLGLEHFLDLRQDAIDAAEQRETGTPRTIEGPLYVANAPLADGH
TRMDDGKDAGEVMWLYGQVNDTQGRPVANAIVDIWHANTLGNYSFFDKSQSEYNLRRRIR
TGADGRYSVRSIMPSGYGCPPDGPTQKLLNQLGRHGNRPAHIHFFVSAPGYKHLTSQINL
NGDKYLWDDFAFATRDGLIADPVKVSDRELIQQRELDGEHTEVRFDFTLCKALNADEEQR
GTRLRAQE