Protein Info for BWI76_RS13660 in Klebsiella michiganensis M5al

Annotation: nitrate reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 TIGR01660: nitrate reductase, beta subunit" amino acids 1 to 493 (493 residues), 986 bits, see alignment E=1.3e-301 PF13247: Fer4_11" amino acids 175 to 271 (97 residues), 125.1 bits, see alignment E=2.8e-40 PF13237: Fer4_10" amino acids 178 to 227 (50 residues), 35.1 bits, see alignment 2.6e-12 PF12838: Fer4_7" amino acids 183 to 229 (47 residues), 30 bits, see alignment 1.5e-10 PF14711: Nitr_red_bet_C" amino acids 358 to 436 (79 residues), 103.1 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 96% identical to NARY_ECOLI: Respiratory nitrate reductase 2 beta chain (narY) from Escherichia coli (strain K12)

KEGG orthology group: K08346, nitrate reductase 2, beta subunit [EC: 1.7.99.4] (inferred from 97% identity to cro:ROD_15701)

MetaCyc: 96% identical to nitrate reductase Z subunit beta (Escherichia coli K-12 substr. MG1655)
1.97.1.-; RXN0-3501 [EC: 1.7.5.1]

Predicted SEED Role

"Respiratory nitrate reductase beta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.5.1 or 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3F5 at UniProt or InterPro

Protein Sequence (514 amino acids)

>BWI76_RS13660 nitrate reductase subunit beta (Klebsiella michiganensis M5al)
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTGREGMEYAWFNNVETKPGIGYPKNWEDQE
VWEGGWVRDVNGKIRPRLGGKMGVITKIFANPVIPQIDDYYEPFTFDYQHLHNAPEGKHL
PTARPRSLIDGKRMDKIIWGPNWEELLGGEFEKRARDRNFDKIQKEMYGQFENTFMMYLP
RLCEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRLCISGCPYKKIYFNWKSGKS
EKCIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEEAASTEREIDLYERQCEVFL
DPHDPAVIEEALKQGIPQNVIDAAQRSPVYKMAMDWKLALPLHPEYRTLPMVWYVPPLSP
IQSYADAGGLPKSDGVLPAIESLRIPVQYLANMLSAGDTGPVLRALKRMMAMRHYMRSQT
VEGVTDTRAIEEVGLSVEQVEEMYRYLAIANYEDRFVIPTSHREMARDAFPERNGCGFTF
GDGCHGSDSKFNLFNSSRIDAINITEVRDKAEGE