Protein Info for BWI76_RS13640 in Klebsiella michiganensis M5al

Annotation: binding-protein-dependent transport system inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 466 to 488 (23 residues), see Phobius details amino acids 494 to 512 (19 residues), see Phobius details amino acids 524 to 545 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 77 to 264 (188 residues), 49.2 bits, see alignment E=2.8e-17 amino acids 365 to 537 (173 residues), 38.7 bits, see alignment E=4.6e-14

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 83% identity to kpu:KP1_2951)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3M6 at UniProt or InterPro

Protein Sequence (551 amino acids)

>BWI76_RS13640 binding-protein-dependent transport system inner membrane protein (Klebsiella michiganensis M5al)
MKQKLISAGTLAVLLVLVGLPLLFIILQAIFPRFSAGSLEGAFSGVAALIADPQLPMMLG
GTLWVACGVALMSVLIGLPLGVLRGLFNVPLPRLWDVLFLIPFLTPPYIAALAWTLLLQS
NGYLQQLTGWDLNDLLFSRSGIVLVMTLNIFPVVYFAVSRSLLASGQRLAIVARVHGARA
WRAFWHITLPMLSPALAAGMLLAFTLAIEEYGVPAALGPRAGLLMLTVGIEKKLADWPID
LPGASLLSLLLMAVALLAWWLQKRLTGDKEVTSVTGKPGENSGAELGWLALPAALLMASV
GGVAVMLPGASMVLTSLMSTLSGGIHGDNFTLRHFTALFAQQGDALSALGTSLSLALASA
LIVGVIGLLAAWLVLVQKMKGSAIVDALSLMPAALPGVVVGVGLILLWNQPFWPVSPYNT
GFMLLLSYCCLLLPWPVRYVGSALRQLGHNLEPAARVHGATPLQALRLIVLPLVFPALLA
AMLMVFAIASRELVTSLLLAPAGTQTVAVFIWRQFEQGSPGQGMAMASLTLFTGLGLMLS
ALALMQRGARE