Protein Info for BWI76_RS13585 in Klebsiella michiganensis M5al
Annotation: 4-oxalocrotonate tautomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to PPTA_KLEP3: Tautomerase PptA (pptA) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 91% identity to kva:Kvar_2416)MetaCyc: 76% identical to tautomerase PptA (Escherichia coli K-12 substr. MG1655)
RXN-19492
Predicted SEED Role
"Probable tautomerase ydcE (EC 5.3.2.-)" (EC 5.3.2.-)
MetaCyc Pathways
- carbazole degradation (2/5 steps found)
- fluorene degradation I (2/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.3.2.-
Use Curated BLAST to search for 5.3.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B3G3 at UniProt or InterPro
Protein Sequence (75 amino acids)
>BWI76_RS13585 4-oxalocrotonate tautomerase (Klebsiella michiganensis M5al) MPHVDIKCFPRELNDEQKTALAADITEVLIRHLNSKESSVSVALQQVEPSDWQQVWDSEI APQMEQLIKKPGYSM