Protein Info for BWI76_RS13565 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 50 to 72 (23 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 315 to 332 (18 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 4 to 192 (189 residues), 28.7 bits, see alignment E=6.4e-11 PF07690: MFS_1" amino acids 18 to 304 (287 residues), 182.1 bits, see alignment E=1.5e-57 TIGR00893: D-galactonate transporter" amino acids 20 to 423 (404 residues), 418.6 bits, see alignment E=1.3e-129

Best Hits

Swiss-Prot: 49% identical to GUDP_ECOLI: Probable glucarate transporter (gudP) from Escherichia coli (strain K12)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 96% identity to kpe:KPK_2459)

MetaCyc: 49% identical to galactarate/D-glucarate transporter GudP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"Possible L-talarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3D6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BWI76_RS13565 MFS transporter (Klebsiella michiganensis M5al)
MQQQLKRSNVRYGILLFLFLATVFNYADRATLSVVAPIMSKELGFDPEAMGLAFSVFGIS
YVIMQIPGGWLLDKYGSRLVYGCALIGWSIVTMFQGTIYMFASPLVALVILRLMMGAIEA
PAFPANSRLSVQWFPNKERGFVTSVYQAAQYISLGIITPLMTIILHNLSWHYVFYYIGAI
GVVLGIFWLVKVRDPSHHPKINQQELDYIREGGGEPELGTKKTQQKLTLAQIKSVCVNRM
MIGVYIGQFCVTSITWFFLTWFPTYLYQAKGMSILKVGFVASIPAIAGFIGGLLGGVFSD
WLLKRGYSLTTARKLPVICGMLLSCVIVVANYTTSEVVVIAAMSVAFFAKGFGNLGWCVL
SDTSPKEMLGIAGGVFNMCGNLASIITPLVIGVIIANTHSFDYAILYVGSMGVLGLFSYL
FIVGPLDRLTLTPRAA