Protein Info for BWI76_RS13550 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 53 to 168 (116 residues), 54.4 bits, see alignment E=7.4e-19 PF00528: BPD_transp_1" amino acids 74 to 273 (200 residues), 65 bits, see alignment E=3.8e-22

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 91% identity to kpn:KPN_01899)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3L9 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BWI76_RS13550 polar amino acid ABC transporter inner membrane subunit (Klebsiella michiganensis M5al)
MHTPETIKVVPARYPLRAVGAALALLALAVVIQSVAFNPRWEWGVFARWFFDPVILEGLG
QTLLLTLLATALSVILGGLLALARLSSSWLLSSLAWGYIWLFRSLPLIVVLIILYNFSYL
YDRLSIGIPFTGISWASFETINVLGQFSTAVVGLTLVQSAYTAEIIRGGFLGVDHGQYEA
AAALGLPASRRTLRIILPQALRTILPAGFNEIISLAKGTAMVYVLAMPELFYTIQMIYNR
TQEVIPLLMVGAAWYLVITSVLSLIQFLVERGLARSERRSAVNTARSSRRAEPVRRPQPQ
EPVHVQLS