Protein Info for BWI76_RS13470 in Klebsiella michiganensis M5al

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details PF04657: DMT_YdcZ" amino acids 7 to 143 (137 residues), 75.6 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 80% identical to YDCZ_ECOLI: Inner membrane protein YdcZ (ydcZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_20085)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3K1 at UniProt or InterPro

Protein Sequence (149 amino acids)

>BWI76_RS13470 transporter (Klebsiella michiganensis M5al)
MNQTLTLACLVAAGVGLVLQNTLMVRITQSASTILIAMLLNSLVGIVIFVTILLLKHGAA
GFQELAVSVKWWTLIPGLLGSFFVFASISGYQNVGAATTIAVLIASQLAGGLVMDLIRAH
HVPLRALIGPLCGAVMLVVGAWLVARRQF