Protein Info for BWI76_RS13455 in Klebsiella michiganensis M5al

Annotation: salicylaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 13 to 466 (454 residues), 454.2 bits, E=2.2e-140

Best Hits

Swiss-Prot: 59% identical to VDH_PSEFL: Vanillin dehydrogenase (vdh) from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 85% identity to kpn:KPN_01919)

MetaCyc: 58% identical to vanillin dehydrogenase (Pseudomonas sp. HR199)
Vanillin dehydrogenase. [EC: 1.2.1.67]

Predicted SEED Role

"4-aminobutyraldehyde dehydrogenase (EC 1.2.1.19)" in subsystem Polyamine Metabolism (EC 1.2.1.19)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
• superpathway of ornithine degradation (8/8 steps found)
• L-lysine degradation X (5/6 steps found)
• putrescine degradation I (2/2 steps found)
• vanillin and vanillate degradation II (2/2 steps found)
• L-lysine degradation I (5/7 steps found)
• putrescine degradation IV (2/3 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• putrescine degradation V (1/2 steps found)
• vanillin and vanillate degradation I (1/2 steps found)
• 4-coumarate degradation (aerobic) (1/5 steps found)
• pinoresinol degradation (1/10 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Arginine and proline metabolism
• Biosynthesis of phenylpropanoids
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.19

Use Curated BLAST to search for 1.2.1.19 or 1.2.1.67

Sequence Analysis Tools

See A0A285B3I3 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BWI76_RS13455 salicylaldehyde dehydrogenase (Klebsiella michiganensis M5al)
MTITCSLYTNGQWHDAEGRGTFTRNNPLTQETASVASAASLADARRCADTAGAAFPQWRD
TVPAERRRLLLEAAEEMLRREAKFIAAMAAETGATAHWAGFNVHLAADILREAAALTTQI
EGQVIPSNVPGNLALAIRQGAGVVLGMAPWNAPLILATRAIATPLACGNTVILKGAELSP
ATQGLIIDALAAAGFPAGVVNYLTCPPADAPALVESLIAHPAVRRINFTGSTPVGRIIAR
TCGEHLKPAILELGGKAPLLVLDDADLEQAAAGAIFGAFANAGQICMSTERIIVDAAVAE
PFVALLAKRAAALPASLLGPVVEMRTVARCNALIEDALAKGARLLAGGMSDSTQMRATLL
DGVTREMRIWHEESFGPVKSIIRVQDEAEALAVANESEYGLSSAIYSRDSARAWNLAQNL
QTGICHINGPTVHDEAQMPFGGCKSSGYGRFGGRAGVAEFTELRWITLQTVPRELPF