Protein Info for BWI76_RS13405 in Klebsiella michiganensis M5al

Annotation: spermidine/putrescine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 56 to 312 (257 residues), 68.9 bits, see alignment E=1.2e-22 PF13416: SBP_bac_8" amino acids 56 to 326 (271 residues), 79.8 bits, see alignment E=4.6e-26

Best Hits

Swiss-Prot: 90% identical to YDCS_ECOLI: Bifunctional polyhydroxybutyrate synthase / ABC transporter periplasmic binding protein (ydcS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_20150)

MetaCyc: 90% identical to putative ABC transporter periplasmic binding protein / polyhydroxybutyrate synthase (Escherichia coli K-12 substr. MG1655)
RXN1-42 [EC: 2.3.1.304]

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3I8 at UniProt or InterPro

Protein Sequence (381 amino acids)

>BWI76_RS13405 spermidine/putrescine ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MSNKIARGSLCVLGMVFLTAQAAEPPTSLDKGEGRLDIIAWPGYIERGQTDKSYDWVSQF
EKESGCQVNVKTAATSDEMVSLMAKGGYDLVTASGDASLRLIMGKRVQPINTALIANWKS
LDPRVEKGAWFNVNGKVYGTPYQWGPNLLMYNTKTFPTPPDSWSAVFVKQNLPDGKTNLG
RVQAYDGPIYIADAALFVKATQPQLGITDPYQLTEAQYQAVLKVLRDQHALIHRYWHDTT
VQMSDFKNEGVVASSAWPYQANGLKAEGQPIATVFPKEGVTGWADTTMLHSEAKHPVCAY
KWMNWSLTPKVQGDVAAWFGSLPVVPAGCKASTLLGDKGCETNGYNEFSKIAFWKTPVAE
GGKFVPYSRWTQDYIAIMGGR