Protein Info for BWI76_RS13375 in Klebsiella michiganensis M5al

Annotation: protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 PF01136: Peptidase_U32" amino acids 20 to 306 (287 residues), 323.7 bits, see alignment E=1e-100 PF12392: DUF3656" amino acids 391 to 505 (115 residues), 71.5 bits, see alignment E=9.4e-24

Best Hits

Swiss-Prot: 88% identical to RLHA_ECOLI: 23S rRNA 5-hydroxycytidine C2501 synthase (rlhA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_20180)

MetaCyc: 88% identical to 23S rRNA 5-hydroxycytidine C2501 synthase (Escherichia coli K-12 substr. MG1655)
RXN-21990

Predicted SEED Role

"putative collagenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B395 at UniProt or InterPro

Protein Sequence (654 amino acids)

>BWI76_RS13375 protease (Klebsiella michiganensis M5al)
MRLQNHHLELLSPARDAGIAREAILHGADAVYIGGPGFGARHNASNSLSDIAGLVPFAHR
YGAKVFVTLNTILHDDELEPAQRLITDLYETGVDALIVQDMGVMELDIPPIELHASTQCD
IRSVEKAKFLSDVGFSQIVLARELNLQQIKAIYDNTDATIEFFIHGALCVAYSGQCNISH
AQTGRSANRGDCSQACRLPYTLKDDQGRVVAYEKHLLSMKDNDQTANLAALIDAGVRSFK
IEGRYKDMSYVKNITAHYRQMLDAIIDDRGDLARASSGRTEHFFVPSTDKTFHRGSTDYF
VNARKGDIGAFDSPKFIGLPVGEVLKVGKDFLDVEVSEALTNGDGLNVMIKREIVGFRAN
TVEKTGENRYRVWPNEMPADLYKVRPHQPLNRNLDHNWQQALLKTSSERRIAVDIELSGW
QEQLVLTMTSEEGVSVTHTLDGEFAEATQAEKALANLRDGVAKLGQTLYYSRNVEINLPG
ALFVPNSLLNQLRRETAEMLDDARLKAVARGSRKPVSVPPPVYPETHLSFLANVYNHKAR
EFYQRYGVQLIDAAYEAHEEKGDVPVMITKHCLRFAFNLCPKQAKGSIKSWKATPMQLIH
GDEVLTLKFDCRPCEMHVVGKIKNHILKMPLPGSIVASVSPDELMKTLPKRKGA