Protein Info for BWI76_RS13360 in Klebsiella michiganensis M5al

Annotation: benzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 123 to 161 (39 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 193 to 194 (2 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 246 to 275 (30 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 349 to 381 (33 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 1 to 382 (382 residues), 532.8 bits, see alignment E=2.6e-164 PF03594: BenE" amino acids 8 to 381 (374 residues), 476.5 bits, see alignment E=2.8e-147

Best Hits

Swiss-Prot: 70% identical to YDCO_ECOLI: Inner membrane protein YdcO (ydcO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to eae:EAE_20190)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3I0 at UniProt or InterPro

Protein Sequence (388 amino acids)

>BWI76_RS13360 benzoate transporter (Klebsiella michiganensis M5al)
MRSFTLPFSTLLAGFVAVLVGYASSAAIIWQAAAAAGADASQIAGWMTALGLGMGVSTLA
LTLWRKGPILTAWSTPGAALLVTGLQGVTLSQAVGVFIFANALIVLCGITGIFARLMKII
PHSLAAAMLAGILLRFGMQAFASLQGNLLLCGSMFAVWLLCKVWLPRFAVVAALLAGGAV
AGFSGEVTTSQIAFSFVAPSWIAPEFTPALLLSVGVPFFLVTMASQNAPGFATLQASGYR
VPVSPLIVATGGLALLLSPFGVYSICIAAITAAICQSPEAHPDPQKRWLAAAAAGVFYLL
AGIFGGSITSLMSALPMAWIQMLAGLALLGTISGSLFQALNQESERDAAVVTFLVTASGV
TLGGVGSAFWGLALGGVSYVLLSTLRRA