Protein Info for BWI76_RS13335 in Klebsiella michiganensis M5al

Annotation: peptidase T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR01882: peptidase T" amino acids 8 to 403 (396 residues), 323 bits, see alignment E=1.4e-100 PF05343: Peptidase_M42" amino acids 143 to 205 (63 residues), 27.9 bits, see alignment E=1.8e-10 PF01546: Peptidase_M20" amino acids 143 to 402 (260 residues), 44.4 bits, see alignment E=2.8e-15 PF07687: M20_dimer" amino acids 209 to 310 (102 residues), 28.1 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 70% identical to Y1009_YERPE: Peptidase T-like protein YPO1009/y3403/YP_3421 (YPO1009) from Yersinia pestis

KEGG orthology group: None (inferred from 89% identity to eae:EAE_20215)

Predicted SEED Role

"Tripeptide aminopeptidase (EC 3.4.11.4)" (EC 3.4.11.4)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.4

Use Curated BLAST to search for 3.4.11.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3I5 at UniProt or InterPro

Protein Sequence (409 amino acids)

>BWI76_RS13335 peptidase T (Klebsiella michiganensis M5al)
MSSALASQLTQRFFRYLAITSQSDPRAATLPTTAGQHAMARALADELRQLGLDEIVIDEH
ATVTAVKRGNVADAPRIGFITHIDTVDVGLSPDIHPQILRFTGEDLCLNREKEIWLRVAE
HPEILAYPDEEIIFSDGTSVLGADNKSAVTVVMTVLENLTPEHRHGDIVVAFVPDEEVGL
RGAKALDLSRFAVDFAWTIDCCELGEIVYENFNAAAAEIRFTGVTAHPMSSKGVLVNPLL
MATDYMSHFDRQQTPEHTAGREGYVWFNGIQGDQNSTLLQASIRDFDLESFTRRKQQIGE
VAQKIAAQYPTGNVEYQVSDIYSNISNAVGEDRRAIDLLFEAMESLGITPKPTPMRGGTD
GAALSAKGILTPNFFTGAHNFHSKFEFLPLRAFEASYQTALQLCLLAAR