Protein Info for BWI76_RS13325 in Klebsiella michiganensis M5al

Annotation: dicarboxylate transporter/tellurite-resistance protein TehA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details PF03595: SLAC1" amino acids 12 to 309 (298 residues), 144.5 bits, see alignment E=2.2e-46 TIGR00816: C4-dicarboxylate transporter/malic acid transport protein" amino acids 13 to 316 (304 residues), 328.6 bits, see alignment E=2.3e-102

Best Hits

Swiss-Prot: 80% identical to TEHA_ECOLI: Tellurite resistance protein TehA (tehA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to eae:EAE_20225)

MetaCyc: 80% identical to tellurite resistance protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-539

Predicted SEED Role

"Tellurite resistance protein TehA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3D7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BWI76_RS13325 dicarboxylate transporter/tellurite-resistance protein TehA (Klebsiella michiganensis M5al)
MNKKQGASRVLNLPAGYFGMVLGLIGMGFAWRYASTIWPVSRIVGDGLVVAATVVWVLLA
LAFIGRAVRFPHSVLQEMRHPVASSFVSLFPATTMLVAIGFVPWLRPLSLVLFSIGVVLQ
LSYAAWQSAGLWRGSHPNEATTPGLYLPTVANNFISAMACGALGFTDAGLVFLGAGLFSW
LSLEPVILQRLRSDGELPMAMRTSLGIQLAPALVACSAWLSVNGGEADTFAKLLFGYGLL
QLLFMLRLMPWYLRQPFNASFWSFSFGVSALATTGLHLGHQHPDGFFHILALPLFLFTNL
IVGLLLIRTFLLLMRGKLLIRVERDTLLKNKD