Protein Info for BWI76_RS13320 in Klebsiella michiganensis M5al

Annotation: putative LpxA-like enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF18836: B_solenoid_ydck" amino acids 107 to 122 (16 residues), 13.3 bits, see alignment (E = 1.1e-05) amino acids 153 to 168 (16 residues), 13.8 bits, see alignment (E = 7.4e-06) amino acids 169 to 185 (17 residues), 23.6 bits, see alignment (E = 5.3e-09)

Best Hits

Swiss-Prot: 56% identical to YDCK_ECOLI: Uncharacterized acetyltransferase YdcK (ydcK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 73% identity to eae:EAE_20230)

Predicted SEED Role

"FIG005189: putative transferase clustered with tellurite resistance proteins TehA/TehB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B382 at UniProt or InterPro

Protein Sequence (326 amino acids)

>BWI76_RS13320 putative LpxA-like enzyme (Klebsiella michiganensis M5al)
MRKYSLSEQVRPFHYQTDGIKHSVNLRQIVALRDFADVKTGDEGGWIDDEAALSHDGECW
IYDANSAVFAGAKIEGNARLTGECIISMGAIVSDNARLDSVHVSHCARLSDNVTASHSQI
RGYCHLADNARILPHCHIIAARGLTADNDKILRIYQRATVSASRIVHQAQIYGDAFVEHA
FVEHRAEIFDQARLEGNDENDVWVCDNARVYGNAKIIAGREEDAIPTLRYSSQVAEHAVV
EGNCLLKHRVMVGGHAHLRGGPILLDDSVLIEGHAVICGDVVIEHQVTIGDRARIEASAG
DAIYIRGEKVINGDEHFTRTPIVGFL