Protein Info for BWI76_RS13300 in Klebsiella michiganensis M5al

Annotation: carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF00135: COesterase" amino acids 6 to 328 (323 residues), 306.7 bits, see alignment E=5.8e-95 amino acids 353 to 475 (123 residues), 41.7 bits, see alignment E=1.2e-14 PF20434: BD-FAE" amino acids 89 to 205 (117 residues), 37.7 bits, see alignment E=2.5e-13 PF07859: Abhydrolase_3" amino acids 161 to 217 (57 residues), 26.7 bits, see alignment 7.1e-10

Best Hits

KEGG orthology group: K03927, carboxylesterase type B [EC: 3.1.1.1] (inferred from 88% identity to kpn:KPN_01946)

Predicted SEED Role

"Putative esterase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3F3 at UniProt or InterPro

Protein Sequence (502 amino acids)

>BWI76_RS13300 carboxylesterase (Klebsiella michiganensis M5al)
MQNPSTPLVKTRQGTLSGTSEENIHIWRGIPYAAPPVGDLRWRAPQPAARWQGVRRAETF
SASSWQDIEYCRELGGGDPGSFSEDCLYLNVWSPASRAQPLPVMVWLHGGGYTIGAGSLP
PYDGKALASRDVVVVTVNYRLGHLGFFAHPALEEEEGERIYNFALLDQIAALQWVQENIH
AFGGDAANVTLFGESAGARSVLSLMVSPKSRGLFHKAIIQSGYTLPDLPREKALAKGQLI
AEHFALPQASAEQLRAIPAEAFWSLTAPLTIGPAPIVGDTVLPQPMLETFFSGRQHPLPV
MIGSNSDEASVMAVFGVDIAGQIQKLRRERRLGLGLIKLLYPGVKGDEALGREVCRDMAF
TTLGYVVMQAQQRVGQPCWRYWFDYVAEAEHQTYPHGAWHGNEVAYVFDNLDLAEPVRQY
ANDRDRTFAGQVADYWANFARVAGNGCHDLQGPVRWPASVRGRDRLLRIGLRKRAGFKVE
NRFMRARLALFRRVMKHHVTLD