Protein Info for BWI76_RS13260 in Klebsiella michiganensis M5al

Annotation: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02818: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase" amino acids 2 to 369 (368 residues), 739.5 bits, see alignment E=3.3e-227 PF08240: ADH_N" amino acids 28 to 123 (96 residues), 87.1 bits, see alignment E=1.1e-28 PF00107: ADH_zinc_N" amino acids 197 to 328 (132 residues), 89.3 bits, see alignment E=3e-29 PF13602: ADH_zinc_N_2" amino acids 231 to 362 (132 residues), 29.1 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 82% identical to FRMA_PHODP: S-(hydroxymethyl)glutathione dehydrogenase (frmA) from Photobacterium damsela subsp. piscicida

KEGG orthology group: None (inferred from 96% identity to eae:EAE_20315)

MetaCyc: 81% identical to S-(hydroxymethyl)glutathione dehydrogenase (Escherichia coli K-12 substr. MG1655)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3F9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BWI76_RS13260 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (Klebsiella michiganensis M5al)
MKSRAAVAFGPGQPLSIVEIDVAPPKKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGIVVEVGEGVTSLQPGDHVIPLYTAECRECKFCKSGKTNLCQAVRSTQGKGLMPD
GTTRFSYNGEPIYHYMGTSTFSEYTVVAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRILAVDTNPEKFTLAREMGATDFINPND
YDKPVQDVIVELTDGGVDFSFECIGNVNVMRAALECCHKGWGESVIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEEAMAGKIRLDPFITHRMPLDRINEAFDLMHEG
KSIRTVIHFGEN