Protein Info for BWI76_RS13250 in Klebsiella michiganensis M5al

Annotation: cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 5 to 172 (168 residues), 85.3 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 81% identical to C561_SHIFL: Cytochrome b561 (cybB) from Shigella flexneri

KEGG orthology group: None (inferred from 89% identity to eae:EAE_20335)

MetaCyc: 81% identical to superoxide oxidase (Escherichia coli K-12 substr. MG1655)
RXN-20148 [EC: 1.10.3.17]

Predicted SEED Role

"Cytochrome b(561)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.10.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3F8 at UniProt or InterPro

Protein Sequence (175 amino acids)

>BWI76_RS13250 cytochrome b561 (Klebsiella michiganensis M5al)
MRDKYSGLQIGIHWLVFFLVIGAYAAMELRGFFPRSARPVINMIHVSCGISIFVLMAVRL
LVRLKSPTPPIVPKPSPMMTGFAHLGHLVIYLLFIALPAIGMVMMYYRGNPWFAFGLTMP
HAAESDFELVDTLKAWHELLANTGYFIIGLHALAALMHHYLWKDNTLLRMMPRRR