Protein Info for BWI76_RS13185 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 421 to 445 (25 residues), see Phobius details amino acids 513 to 533 (21 residues), see Phobius details PF07690: MFS_1" amino acids 48 to 366 (319 residues), 35.7 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to eae:EAE_20420)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3K0 at UniProt or InterPro

Protein Sequence (550 amino acids)

>BWI76_RS13185 MFS transporter (Klebsiella michiganensis M5al)
MPRRKDNPYVPHDWAPHEKPAILGSPSTPIHSTPKRIAYGIVGLLVCLTGALGNAVVTAN
LQLLQGTFAAWSTEIAWLPAVYVMTNVSINLLLVKFRQQFGLRAFTEGFLVLYVLVTFFH
LFVNDLSSALMVRAAHGMVAAALSSLGIYYQVQAWPARHRLKALTIGITGSSLAIPLARL
FSTELLQIDEWRGLYFFELGLALVSLACVIALKLPPSDRKKVFEKKDFITFFLLAPGMAL
VTAVLSLGRLDWWFEAPWIGWALAGAVVLIVSAIAFEHNRSNPLLNIKWLSSGSILRLGL
IMLLIRIVLAEQNTGVIGWLQYVGLQNEQMTNLAWSIFAGILCGIVASCLTLNPQRLYWP
TATALALIMVGSLLDSQSTILTRPEQLMFSQFLLGFGSAFFLAPAMLAGIGGVIADQRNL
VSFSVLFGMSQNIGGLLGSAILGTFQTWREKFHSSQLADQLTTLNPLITERLQQYSQMYQ
SQIGDSTLLNVQATTLLQNAATLQANILAYNDTYLLTAAISAATLVWVFWRLIRLRITAR
IALKRATGSK