Protein Info for BWI76_RS13150 in Klebsiella michiganensis M5al

Annotation: carnitine operon protein CaiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR02287: phenylacetic acid degradation protein PaaY" amino acids 3 to 195 (193 residues), 361.7 bits, see alignment E=4e-113 PF00132: Hexapep" amino acids 88 to 122 (35 residues), 33 bits, see alignment 1.7e-12

Best Hits

Swiss-Prot: 88% identical to PAAY_ECOLI: Phenylacetic acid degradation protein PaaY (paaY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_20455)

MetaCyc: 88% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3D8 at UniProt or InterPro

Protein Sequence (198 amino acids)

>BWI76_RS13150 carnitine operon protein CaiE (Klebsiella michiganensis M5al)
MPIYQIDGMTPVVPDESYVHPTAVLIGDVILGKGVYVGPNASLRGDFGRIVVKDGANIQD
NCVMHGFPGQDTVVEEEGHIGHGAILHGCTIGRNALVGMSAVIIDGASIGENSIVGASAF
VKANAEMPANHLIVGSPAKAIRTLSEQELAWKKQGTREYQMLVERCKQTLHQVEPLKEAE
PDRKRLAFDENLRPKSSS